Lineage for d1kpkc_ (1kpk C:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745392Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 745393Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 745394Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 745395Protein Clc chloride channel [69913] (2 species)
  7. 745396Species Escherichia coli [TaxId:562] [69914] (9 PDB entries)
  8. 745409Domain d1kpkc_: 1kpk C: [68778]

Details for d1kpkc_

PDB Entry: 1kpk (more details), 3.5 Å

PDB Description: Crystal Structure of the ClC Chloride Channel from E. coli
PDB Compounds: (C:) putative channel transporter

SCOP Domain Sequences for d1kpkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpkc_ f.20.1.1 (C:) Clc chloride channel {Escherichia coli [TaxId: 562]}
qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
atllaqftggkplysailartlakqeaeql

SCOP Domain Coordinates for d1kpkc_:

Click to download the PDB-style file with coordinates for d1kpkc_.
(The format of our PDB-style files is described here.)

Timeline for d1kpkc_: