Lineage for d1kpka_ (1kpk A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456404Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1456405Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1456406Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1456407Protein Clc chloride channel [69913] (2 species)
  7. 1456408Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1456439Domain d1kpka_: 1kpk A: [68776]

Details for d1kpka_

PDB Entry: 1kpk (more details), 3.5 Å

PDB Description: Crystal Structure of the ClC Chloride Channel from E. coli
PDB Compounds: (A:) putative channel transporter

SCOPe Domain Sequences for d1kpka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpka_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]}
qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
atllaqftggkplysailartlakqeaeql

SCOPe Domain Coordinates for d1kpka_:

Click to download the PDB-style file with coordinates for d1kpka_.
(The format of our PDB-style files is described here.)

Timeline for d1kpka_: