Lineage for d1kpka_ (1kpk A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. Protein Clc chloride channel [69913] (2 species)
  7. Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. Domain d1kpka_: 1kpk A: [68776]

Details for d1kpka_

PDB Entry: 1kpk (more details), 3.5 Å

PDB Description: Crystal Structure of the ClC Chloride Channel from E. coli
PDB Compounds: (A:) putative channel transporter

SCOPe Domain Sequences for d1kpka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpka_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]}
qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
atllaqftggkplysailartlakqeaeql

SCOPe Domain Coordinates for d1kpka_ are not available.

Timeline for d1kpka_:

Domains from other chains:
(mouse over for more information)
d1kpkb_, d1kpkc_, d1kpkd_, d1kpke_, d1kpkf_