Lineage for d1kpjy_ (1kpj Y:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (6 PDB entries)
  8. 146367Domain d1kpjy_: 1kpj Y: [68774]

Details for d1kpjy_

PDB Entry: 1kpj (more details), 3.1 Å

PDB Description: Crystal structure of the large ribosomal subunit from Deinococcus radiodurans

SCOP Domain Sequences for d1kpjy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpjy_ i.1.1.2 (Y:) 50S subunit {Deinococcus radiodurans}
mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
krfgdsyrrgskk

SCOP Domain Coordinates for d1kpjy_:

Click to download the PDB-style file with coordinates for d1kpjy_.
(The format of our PDB-style files is described here.)

Timeline for d1kpjy_:

  • d1kpjy_ is new in SCOP 1.59
  • d1kpjy_ does not appear in SCOP 1.61