Lineage for d1kpjb_ (1kpj B:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (6 PDB entries)
  8. 146344Domain d1kpjb_: 1kpj B: [68751]

Details for d1kpjb_

PDB Entry: 1kpj (more details), 3.1 Å

PDB Description: Crystal structure of the large ribosomal subunit from Deinococcus radiodurans

SCOP Domain Sequences for d1kpjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpjb_ i.1.1.2 (B:) 50S subunit {Deinococcus radiodurans}
mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
lilvkgaipgangglvvlrsaakas

SCOP Domain Coordinates for d1kpjb_:

Click to download the PDB-style file with coordinates for d1kpjb_.
(The format of our PDB-style files is described here.)

Timeline for d1kpjb_:

  • d1kpjb_ is new in SCOP 1.59
  • d1kpjb_ became obsolete in SCOP 1.61