Lineage for d1kpia_ (1kpi A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) 
Family c.66.1.18: Mycolic acid cyclopropane synthase CmaA1 [69560] (1 protein) Protein Mycolic acid cyclopropane synthase CmaA1 [69561] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [69562] (4 PDB entries) 
Domain d1kpia_: 1kpi A: [68743]
Details for d1kpia_
PDB Entry: 1kpi (more details), 2.65 Å
PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA2 complexed with SAH and DDDMAB
SCOP Domain Sequences for d1kpia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpia_ c.66.1.18 (A:) Mycolic acid cyclopropane synthase CmaA1 {Mycobacterium tuberculosis}
qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldklnle
pgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgw
eefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkee
aqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptl
nawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk
SCOP Domain Coordinates for d1kpia_:
Click to download the PDB-style file with coordinates for d1kpia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kpia_:
- d1kpia_ is new in SCOP 1.59
- d1kpia_ appears in SCOP 1.61
- d1kpia_ appears in the current release, SCOPe 2.08
View in 3D