Lineage for d1kphc_ (1kph C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125737Family c.66.1.18: Mycolic acid cyclopropane synthase CmaA1 [69560] (1 protein)
  6. 125738Protein Mycolic acid cyclopropane synthase CmaA1 [69561] (1 species)
  7. 125739Species Mycobacterium tuberculosis [TaxId:1773] [69562] (4 PDB entries)
  8. 125746Domain d1kphc_: 1kph C: [68741]

Details for d1kphc_

PDB Entry: 1kph (more details), 2 Å

PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and DDDMAB

SCOP Domain Sequences for d1kphc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kphc_ c.66.1.18 (C:) Mycolic acid cyclopropane synthase CmaA1 {Mycobacterium tuberculosis}
delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl
qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag
weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl
pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa
lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk

SCOP Domain Coordinates for d1kphc_:

Click to download the PDB-style file with coordinates for d1kphc_.
(The format of our PDB-style files is described here.)

Timeline for d1kphc_: