Lineage for d1kpha_ (1kph A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318334Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 318335Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (30 families) (S)
  5. 318494Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (2 proteins)
  6. 318495Protein CmaA1 [69561] (1 species)
  7. 318496Species Mycobacterium tuberculosis [TaxId:1773] [69562] (4 PDB entries)
  8. 318501Domain d1kpha_: 1kph A: [68739]

Details for d1kpha_

PDB Entry: 1kph (more details), 2 Å

PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and DDDMAB

SCOP Domain Sequences for d1kpha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpha_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis}
lkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqp
gmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagwe
qfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglpm
sftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalq
ankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk

SCOP Domain Coordinates for d1kpha_:

Click to download the PDB-style file with coordinates for d1kpha_.
(The format of our PDB-style files is described here.)

Timeline for d1kpha_: