Lineage for d1kpha_ (1kph A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893430Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 2893431Protein CmaA1 [69561] (1 species)
  7. 2893432Species Mycobacterium tuberculosis [TaxId:1773] [69562] (3 PDB entries)
  8. 2893437Domain d1kpha_: 1kph A: [68739]
    complexed with 10a, co3, sah

Details for d1kpha_

PDB Entry: 1kph (more details), 2 Å

PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and DDDMAB
PDB Compounds: (A:) cyclopropane-fatty-acyl-phospholipid synthase 1

SCOPe Domain Sequences for d1kpha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpha_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}
lkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqp
gmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagwe
qfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglpm
sftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalq
ankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk

SCOPe Domain Coordinates for d1kpha_:

Click to download the PDB-style file with coordinates for d1kpha_.
(The format of our PDB-style files is described here.)

Timeline for d1kpha_: