SCOP 1.75: Domain d1kpgd_: 1kpg D:

Lineage for d1kpgd_ (1kpg D:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (6 proteins)

6. Protein CmaA1 [69561] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [69562] (3 PDB entries)

8. Domain d1kpgd_: 1kpg D: [68738]
   complexed with 16a, co3, sah

Details for d1kpgd_

PDB Entry: 1kpg, 2 Å

PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB

PDB Compounds: (D:) cyclopropane-fatty-acyl-phospholipid synthase 1

SCOP Domain Sequences for d1kpgd_:

Sequence; same for both SEQRES and ATOM records:

>d1kpgd_ c.66.1.18 (D:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}
lkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqp
gmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagwe
qfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglpm
sftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalq
ankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk

Timeline for d1kpgd_:

• d1kpgd_ first appeared in SCOP 1.59
  
• d1kpgd_ appears in SCOP 1.73
  
• d1kpgd_ appears in SCOPe 2.01
  
• d1kpgd_ appears in the current release, SCOPe 2.08