SCOP 1.65: Domain d1kpgb_: 1kpg B:

Lineage for d1kpgb_ (1kpg B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (30 families)

5. Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (2 proteins)

6. Protein CmaA1 [69561] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [69562] (4 PDB entries)

8. Domain d1kpgb_: 1kpg B: [68736]

Details for d1kpgb_

PDB Entry: 1kpg, 2 Å

PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB

SCOP Domain Sequences for d1kpgb_:

Sequence; same for both SEQRES and ATOM records:

>d1kpgb_ c.66.1.18 (B:) CmaA1 {Mycobacterium tuberculosis}
elkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglq
pgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagw
eqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglp
msftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaal
qankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk

Timeline for d1kpgb_:

• d1kpgb_ first appeared in SCOP 1.59
  
• d1kpgb_ appears in SCOP 1.63
  
• d1kpgb_ appears in SCOP 1.67
  
• d1kpgb_ appears in the current release, SCOPe 2.08