Lineage for d1kpgb_ (1kpg B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (20 families) 
Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (2 proteins) Protein CmaA1 [69561] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [69562] (4 PDB entries) 
Domain d1kpgb_: 1kpg B: [68736]
Details for d1kpgb_
PDB Entry: 1kpg (more details), 2 Å
PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB
SCOP Domain Sequences for d1kpgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpgb_ c.66.1.18 (B:) CmaA1 {Mycobacterium tuberculosis}
elkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglq
pgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagw
eqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglp
msftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaal
qankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
SCOP Domain Coordinates for d1kpgb_:
Click to download the PDB-style file with coordinates for d1kpgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kpgb_:
- d1kpgb_ first appeared in SCOP 1.59
- d1kpgb_ appears in SCOP 1.63
- d1kpgb_ appears in the current release, SCOPe 2.08
View in 3D
