Lineage for d1kpga_ (1kpg A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247550Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 247551Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (23 families) (S)
  5. 247751Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (2 proteins)
  6. 247752Protein CmaA1 [69561] (1 species)
  7. 247753Species Mycobacterium tuberculosis [TaxId:1773] [69562] (4 PDB entries)
  8. 247754Domain d1kpga_: 1kpg A: [68735]

Details for d1kpga_

PDB Entry: 1kpg (more details), 2 Å

PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB

SCOP Domain Sequences for d1kpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis}
delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl
qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag
weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl
pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa
lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk

SCOP Domain Coordinates for d1kpga_:

Click to download the PDB-style file with coordinates for d1kpga_.
(The format of our PDB-style files is described here.)

Timeline for d1kpga_: