Lineage for d1kp9b_ (1kp9 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399537Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (2 proteins)
  6. 399538Protein CmaA1 [69561] (1 species)
  7. 399539Species Mycobacterium tuberculosis [TaxId:1773] [69562] (4 PDB entries)
  8. 399549Domain d1kp9b_: 1kp9 B: [68734]
    complexed with acy

Details for d1kp9b_

PDB Entry: 1kp9 (more details), 2.21 Å

PDB Description: Crystal structure of mycolic acid cyclopropane synthase CmaA1, apo-form

SCOP Domain Sequences for d1kp9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kp9b_ c.66.1.18 (B:) CmaA1 {Mycobacterium tuberculosis}
lsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtlldvgcgwga
tmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsig
afehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivt
eifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqsee
vyerymkyltgcaemfrigyidvnqftcqk

SCOP Domain Coordinates for d1kp9b_:

Click to download the PDB-style file with coordinates for d1kp9b_.
(The format of our PDB-style files is described here.)

Timeline for d1kp9b_: