Lineage for d1kp9a_ (1kp9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1864964Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 1864965Protein CmaA1 [69561] (1 species)
  7. 1864966Species Mycobacterium tuberculosis [TaxId:1773] [69562] (3 PDB entries)
  8. 1864975Domain d1kp9a_: 1kp9 A: [68733]
    complexed with acy

Details for d1kp9a_

PDB Entry: 1kp9 (more details), 2.21 Å

PDB Description: Crystal structure of mycolic acid cyclopropane synthase CmaA1, apo-form
PDB Compounds: (A:) cyclopropane-fatty-acyl-phospholipid synthase 1

SCOPe Domain Sequences for d1kp9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kp9a_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}
lsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtlldvgcgwga
tmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsig
afehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivt
eifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqsee
vyerymkyltgcaemfrigyidvnqftcqk

SCOPe Domain Coordinates for d1kp9a_:

Click to download the PDB-style file with coordinates for d1kp9a_.
(The format of our PDB-style files is described here.)

Timeline for d1kp9a_: