Lineage for d1kota_ (1kot A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893478Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 1893479Protein GABA(A) receptor associated protein GABARAP [69658] (2 species)
  7. 1893480Species Human (Homo sapiens) [TaxId:9606] [69659] (6 PDB entries)
  8. 1893485Domain d1kota_: 1kot A: [68732]

Details for d1kota_

PDB Entry: 1kot (more details)

PDB Description: Solution Structure of Human GABA Receptor Associated Protein GABARAP
PDB Compounds: (A:) gabarap

SCOPe Domain Sequences for d1kota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kota_ d.15.1.3 (A:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

SCOPe Domain Coordinates for d1kota_:

Click to download the PDB-style file with coordinates for d1kota_.
(The format of our PDB-style files is described here.)

Timeline for d1kota_: