Lineage for d1kooc2 (1koo C:101-200)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195604Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 2195605Protein mRNA export factor tap [54955] (1 species)
  7. 2195606Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 2195610Domain d1kooc2: 1koo C:101-200 [68730]
    Other proteins in same PDB: d1kooa1, d1koob_, d1kooc1, d1kood_
    mutant

Details for d1kooc2

PDB Entry: 1koo (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor
PDB Compounds: (C:) tip associating protein

SCOPe Domain Sequences for d1kooc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kooc2 d.58.7.2 (C:101-200) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
apperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhyentraq
ffvedastasalkavnykildrenrrisiiinssapphti

SCOPe Domain Coordinates for d1kooc2:

Click to download the PDB-style file with coordinates for d1kooc2.
(The format of our PDB-style files is described here.)

Timeline for d1kooc2: