SCOP 1.59: Domain d1kohc1: 1koh C:201-362

Lineage for d1kohc1 (1koh C:201-362)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)

4. Superfamily c.10.2: L domain-like [52058] (6 families)

5. Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
   this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain

6. Protein mRNA export factor tap [52066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)

8. Domain d1kohc1: 1koh C:201-362 [68722]
   Other proteins in same PDB: d1koha2, d1kohc2

Details for d1kohc1

PDB Entry: 1koh, 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor

SCOP Domain Sequences for d1kohc1:

Sequence; same for both SEQRES and ATOM records:

>d1kohc1 c.10.2.3 (C:201-362) mRNA export factor tap {Human (Homo sapiens)}
lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii
eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel
wldgnslsdtfrdqstyisairerfpkllrldghelpppiaf

Timeline for d1kohc1:

• d1kohc1 is new in SCOP 1.59
  
• d1kohc1 appears in SCOP 1.61
  
• d1kohc1 appears in the current release, SCOPe 2.08