Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.3: mRNA export factor tap [52065] (1 protein) this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain |
Protein mRNA export factor tap [52066] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries) |
Domain d1kohb_: 1koh B: [68721] Other proteins in same PDB: d1koha2, d1kohc2 mutant |
PDB Entry: 1koh (more details), 3.8 Å
SCOPe Domain Sequences for d1kohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kohb_ c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel wldgnslsdtfrdqstyisairerfpkllrldghelpppiafdveap
Timeline for d1kohb_: