Lineage for d1kmja_ (1kmj A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125751Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 125752Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 125954Family c.67.1.3: Cystathionine synthase-like [53402] (7 proteins)
  6. 126049Protein NifS-like protein/selenocysteine lyase [53412] (2 species)
  7. 126050Species Escherichia coli [TaxId:562] [53414] (4 PDB entries)
  8. 126052Domain d1kmja_: 1kmj A: [68695]

Details for d1kmja_

PDB Entry: 1kmj (more details), 2 Å

PDB Description: E. coli NifS/CsdB protein at 2.0A with the cysteine persulfide intermediate (residue CSS).

SCOP Domain Sequences for d1kmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmja_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli}
ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOP Domain Coordinates for d1kmja_:

Click to download the PDB-style file with coordinates for d1kmja_.
(The format of our PDB-style files is described here.)

Timeline for d1kmja_: