Lineage for d1kkra2 (1kkr A:1-160)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947584Protein beta-Methylaspartase [69714] (2 species)
  7. 2947585Species Citrobacter amalonaticus [TaxId:35703] [69716] (2 PDB entries)
  8. 2947588Domain d1kkra2: 1kkr A:1-160 [68684]
    Other proteins in same PDB: d1kkra1, d1kkrb1
    complexed with 2as, mg

Details for d1kkra2

PDB Entry: 1kkr (more details), 2.1 Å

PDB Description: crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase containing (2s,3s)-3-methylaspartic acid
PDB Compounds: (A:) 3-methylaspartate ammonia-lyase

SCOPe Domain Sequences for d1kkra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkra2 d.54.1.1 (A:1-160) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]}
mkikqalftagyssfyfddqqaikngaghdgfiytgdpvtpgftsvrqagecvsvqlile
ngavavgdcaavqysgaggrdplflaehfipflndhikpllegrdvdaflpnarffdklr
idgnllhtavryglsqalldatalasgrlktevvcdewql

SCOPe Domain Coordinates for d1kkra2:

Click to download the PDB-style file with coordinates for d1kkra2.
(The format of our PDB-style files is described here.)

Timeline for d1kkra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kkra1