Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein beta-Methylaspartase [69714] (2 species) |
Species Citrobacter amalonaticus [TaxId:35703] [69716] (2 PDB entries) |
Domain d1kkoa2: 1kko A:1-160 [68676] Other proteins in same PDB: d1kkoa1, d1kkob1 complexed with so4 |
PDB Entry: 1kko (more details), 1.33 Å
SCOPe Domain Sequences for d1kkoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkoa2 d.54.1.1 (A:1-160) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} mkikqalftagyssfyfddqqaikngaghdgfiytgdpvtpgftsvrqagecvsvqlile ngavavgdcaavqysgaggrdplflaehfipflndhikpllegrdvdaflpnarffdklr idgnllhtavryglsqalldatalasgrlktevvcdewql
Timeline for d1kkoa2: