Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (6 species) |
Species Aspergillus fumigatus [TaxId:5085] [69693] (1 PDB entry) |
Domain d1kkcx2: 1kkc X:98-214 [68665] Other proteins in same PDB: d1kkca1, d1kkcb1, d1kkcx1, d1kkcy1 |
PDB Entry: 1kkc (more details), 2 Å
SCOP Domain Sequences for d1kkcx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkcx2 d.44.1.1 (X:98-214) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus} eksgggkidqapvlkaaieqrwgsfdkfkdafnttllgiqgsgwgwlvtdgpkgklditt thdqdpvtgaapvfgvdmwehayylqylndkasyakgiwnvinwaeaenryiagdkg
Timeline for d1kkcx2: