Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries) |
Domain d1kh0a_: 1kh0 A: [68604] b1 domain; computer-designed conformation in the second turn |
PDB Entry: 1kh0 (more details), 1.9 Å
SCOPe Domain Sequences for d1kh0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kh0a_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]} eevtikanlifangstqtaefkgtkekalsevlayadtlkkdngewtidkrvtngviiln ikfag
Timeline for d1kh0a_: