Class b: All beta proteins [48724] (144 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Animal alpha-amylase [51024] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [51026] (23 PDB entries) |
Domain d1kgua1: 1kgu A:404-496 [68598] Other proteins in same PDB: d1kgua2 |
PDB Entry: 1kgu (more details), 2 Å
SCOP Domain Sequences for d1kgua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgua1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)} qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct gikiyvsddgkahfsisnsaedpfiaihaeskl
Timeline for d1kgua1: