Lineage for d1kgod_ (1kgo D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639250Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 639263Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (4 PDB entries)
  8. 639279Domain d1kgod_: 1kgo D: [68591]
    complexed with fe2

Details for d1kgod_

PDB Entry: 1kgo (more details), 2.25 Å

PDB Description: R2F from Corynebacterium Ammoniagenes in its reduced, Fe containing, form
PDB Compounds: (D:) Ribonucleotide reductase protein R2F

SCOP Domain Sequences for d1kgod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgod_ a.25.1.2 (D:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d1kgod_:

Click to download the PDB-style file with coordinates for d1kgod_.
(The format of our PDB-style files is described here.)

Timeline for d1kgod_: