SCOPe 2.05: Domain d1kgoc_: 1kgo C:

Lineage for d1kgoc_ (1kgo C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)

8. Domain d1kgoc_: 1kgo C: [68590]
   complexed with fe2

Details for d1kgoc_

PDB Entry: 1kgo, 2.25 Å

PDB Description: R2F from Corynebacterium Ammoniagenes in its reduced, Fe containing, form

PDB Compounds: (C:) Ribonucleotide reductase protein R2F

SCOPe Domain Sequences for d1kgoc_:

Sequence; same for both SEQRES and ATOM records:

>d1kgoc_ a.25.1.2 (C:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

Timeline for d1kgoc_:

• d1kgoc_ first appeared in SCOP 1.59
  
• d1kgoc_ appears in SCOPe 2.04
  
• d1kgoc_ appears in SCOPe 2.06
  
• d1kgoc_ appears in the current release, SCOPe 2.08