SCOP 1.75: Domain d1kgob_: 1kgo B:

Lineage for d1kgob_ (1kgo B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (5 PDB entries)

8. Domain d1kgob_: 1kgo B: [68589]

Details for d1kgob_

PDB Entry: 1kgo, 2.25 Å

PDB Description: R2F from Corynebacterium Ammoniagenes in its reduced, Fe containing, form

PDB Compounds: (B:) Ribonucleotide reductase protein R2F

SCOP Domain Sequences for d1kgob_:

Sequence; same for both SEQRES and ATOM records:

>d1kgob_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

Timeline for d1kgob_:

• d1kgob_ first appeared in SCOP 1.59
  
• d1kgob_ appears in SCOP 1.73
  
• d1kgob_ appears in SCOPe 2.01
  
• d1kgob_ appears in the current release, SCOPe 2.08