Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Ribonucleotide reductase R2 [47257] (10 species) |
Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries) |
Domain d1kgob_: 1kgo B: [68589] complexed with fe2 |
PDB Entry: 1kgo (more details), 2.25 Å
SCOPe Domain Sequences for d1kgob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgob_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
Timeline for d1kgob_: