Lineage for d1kgoa_ (1kgo A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279915Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 280027Protein Ribonucleotide reductase R2 [47257] (6 species)
  7. 280032Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (3 PDB entries)
  8. 280041Domain d1kgoa_: 1kgo A: [68588]

Details for d1kgoa_

PDB Entry: 1kgo (more details), 2.25 Å

PDB Description: R2F from Corynebacterium Ammoniagenes in its reduced, Fe containing, form

SCOP Domain Sequences for d1kgoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgoa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d1kgoa_:

Click to download the PDB-style file with coordinates for d1kgoa_.
(The format of our PDB-style files is described here.)

Timeline for d1kgoa_: