Lineage for d1kgnc_ (1kgn C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212337Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 212429Protein Ribonucleotide reductase R2 [47257] (5 species)
  7. 212433Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (3 PDB entries)
  8. 212436Domain d1kgnc_: 1kgn C: [68586]

Details for d1kgnc_

PDB Entry: 1kgn (more details), 1.85 Å

PDB Description: r2f from corynebacterium ammoniagenes in its oxidised, fe containing, form

SCOP Domain Sequences for d1kgnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgnc_ a.25.1.2 (C:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d1kgnc_:

Click to download the PDB-style file with coordinates for d1kgnc_.
(The format of our PDB-style files is described here.)

Timeline for d1kgnc_: