Lineage for d1kfxl2 (1kfx L:356-514)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773820Fold b.14: Calpain large subunit, middle domain (domain III) [49757] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2773821Superfamily b.14.1: Calpain large subunit, middle domain (domain III) [49758] (2 families) (S)
    automatically mapped to Pfam PF01067
  5. 2773822Family b.14.1.1: Calpain large subunit, middle domain (domain III) [49759] (1 protein)
  6. 2773823Protein Calpain large subunit, middle domain (domain III) [49760] (3 species)
  7. 2773824Species Human (Homo sapiens), M-type [TaxId:9606] [49761] (2 PDB entries)
  8. 2773826Domain d1kfxl2: 1kfx L:356-514 [68576]
    Other proteins in same PDB: d1kfxl1, d1kfxl3, d1kfxs_

Details for d1kfxl2

PDB Entry: 1kfx (more details), 3.15 Å

PDB Description: Crystal Structure of Human m-Calpain Form I
PDB Compounds: (L:) m-calpain large subunit

SCOPe Domain Sequences for d1kfxl2:

Sequence, based on SEQRES records: (download)

>d1kfxl2 b.14.1.1 (L:356-514) Calpain large subunit, middle domain (domain III) {Human (Homo sapiens), M-type [TaxId: 9606]}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededeedgesgctflvgliqkh
rrrqrkmgedmhtigfgiyevpeelsgqtnihlsknffltnrarersdtfinlrevlnrf
klppgeyilvpstfepnkdgdfcirvfsekkadyqavdd

Sequence, based on observed residues (ATOM records): (download)

>d1kfxl2 b.14.1.1 (L:356-514) Calpain large subunit, middle domain (domain III) {Human (Homo sapiens), M-type [TaxId: 9606]}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeedectflvgliqkhrrrqrkmg
edmhtigfgiyevpeetnihlsknffltnrarersdtfinlrevlnrfklppgeyilvps
tfepnkdgdfcirvfsekkadyqavdd

SCOPe Domain Coordinates for d1kfxl2:

Click to download the PDB-style file with coordinates for d1kfxl2.
(The format of our PDB-style files is described here.)

Timeline for d1kfxl2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfxs_