Lineage for d1kfxl1 (1kfx L:515-700)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 769216Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 769220Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (3 species)
  7. 769221Species Human (Homo sapiens), M-type [TaxId:9606] [47557] (2 PDB entries)
  8. 769223Domain d1kfxl1: 1kfx L:515-700 [68575]
    Other proteins in same PDB: d1kfxl2, d1kfxl3, d1kfxs_

Details for d1kfxl1

PDB Entry: 1kfx (more details), 3.15 Å

PDB Description: Crystal Structure of Human m-Calpain Form I
PDB Compounds: (L:) m-calpain large subunit

SCOP Domain Sequences for d1kfxl1:

Sequence, based on SEQRES records: (download)

>d1kfxl1 a.39.1.8 (L:515-700) Calpain large subunit, C-terminal domain (domain IV) {Human (Homo sapiens), M-type [TaxId: 9606]}
eieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfsi
etckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlisw
lcfsvl

Sequence, based on observed residues (ATOM records): (download)

>d1kfxl1 a.39.1.8 (L:515-700) Calpain large subunit, C-terminal domain (domain IV) {Human (Homo sapiens), M-type [TaxId: 9606]}
eieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrksdgfsietc
kimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleeagfk
mpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldliswlcf
svl

SCOP Domain Coordinates for d1kfxl1:

Click to download the PDB-style file with coordinates for d1kfxl1.
(The format of our PDB-style files is described here.)

Timeline for d1kfxl1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfxs_