![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (5 proteins) |
![]() | Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47553] (2 PDB entries) |
![]() | Domain d1kfus_: 1kfu S: [68574] Other proteins in same PDB: d1kful1, d1kful2, d1kful3 |
PDB Entry: 1kfu (more details), 2.5 Å
SCOP Domain Sequences for d1kfus_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfus_ a.39.1.8 (S:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens)} thysnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql tmys
Timeline for d1kfus_: