SCOP 1.75: Domain d1kful3: 1kfu L:2-355

Lineage for d1kful3 (1kfu L:2-355)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
   includes the N-terminal 'sequence' domain I

7. Species Human (Homo sapiens), M-type [TaxId:9606] [54042] (2 PDB entries)

8. Domain d1kful3: 1kfu L:2-355 [68573]
   Other proteins in same PDB: d1kful1, d1kful2, d1kfus_

Details for d1kful3

PDB Entry: 1kfu, 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II

PDB Compounds: (L:) m-calpain large subunit

SCOP Domain Sequences for d1kful3:

Sequence; same for both SEQRES and ATOM records:

>d1kful3 d.3.1.3 (L:2-355) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), M-type [TaxId: 9606]}
agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk
elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil
arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
ekayakingcyealsggattegfedftggiaewyelkkpppnlfkiiqkalqkgsllgcs
iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgrwndnc
pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykk

Timeline for d1kful3:

• d1kful3 first appeared in SCOP 1.59
  
• d1kful3 appears in SCOP 1.73
  
• d1kful3 appears in SCOPe 2.01
  
• d1kful3 appears in the current release, SCOPe 2.08