Lineage for d1kful2 (1kfu L:356-514)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941911Fold b.14: Calpain large subunit, middle domain (domain III) [49757] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 941912Superfamily b.14.1: Calpain large subunit, middle domain (domain III) [49758] (1 family) (S)
  5. 941913Family b.14.1.1: Calpain large subunit, middle domain (domain III) [49759] (1 protein)
  6. 941914Protein Calpain large subunit, middle domain (domain III) [49760] (3 species)
  7. 941915Species Human (Homo sapiens), M-type [TaxId:9606] [49761] (2 PDB entries)
  8. 941916Domain d1kful2: 1kfu L:356-514 [68572]
    Other proteins in same PDB: d1kful1, d1kful3, d1kfus_

Details for d1kful2

PDB Entry: 1kfu (more details), 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II
PDB Compounds: (L:) m-calpain large subunit

SCOPe Domain Sequences for d1kful2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kful2 b.14.1.1 (L:356-514) Calpain large subunit, middle domain (domain III) {Human (Homo sapiens), M-type [TaxId: 9606]}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededeedgesgctflvgliqkh
rrrqrkmgedmhtigfgiyevpeelsgqtnihlsknffltnrarersdtfinlrevlnrf
klppgeyilvpstfepnkdgdfcirvfsekkadyqavdd

SCOPe Domain Coordinates for d1kful2:

Click to download the PDB-style file with coordinates for d1kful2.
(The format of our PDB-style files is described here.)

Timeline for d1kful2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfus_