Lineage for d1kekb3 (1kek B:259-415)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245392Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 245393Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 245429Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 245430Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 245431Species Desulfovibrio africanus [TaxId:873] [52933] (3 PDB entries)
  8. 245433Domain d1kekb3: 1kek B:259-415 [68531]
    Other proteins in same PDB: d1keka1, d1keka2, d1keka4, d1keka5, d1kekb1, d1kekb2, d1kekb4, d1kekb5
    complexed with ca, co2, fs4, htl, mg

Details for d1kekb3

PDB Entry: 1kek (more details), 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase

SCOP Domain Sequences for d1kekb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kekb3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOP Domain Coordinates for d1kekb3:

Click to download the PDB-style file with coordinates for d1kekb3.
(The format of our PDB-style files is described here.)

Timeline for d1kekb3: