Lineage for d1kekb1 (1kek B:2-258)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121562Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 121563Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 121652Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein)
  6. 121653Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species)
  7. 121654Species Desulfovibrio africanus [TaxId:873] [52538] (3 PDB entries)
  8. 121657Domain d1kekb1: 1kek B:2-258 [68529]
    Other proteins in same PDB: d1keka3, d1keka4, d1keka5, d1kekb3, d1kekb4, d1kekb5

Details for d1kekb1

PDB Entry: 1kek (more details), 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase

SCOP Domain Sequences for d1kekb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kekb1 c.36.1.4 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOP Domain Coordinates for d1kekb1:

Click to download the PDB-style file with coordinates for d1kekb1.
(The format of our PDB-style files is described here.)

Timeline for d1kekb1: