Lineage for d1keka5 (1kek A:669-785)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257062Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 257149Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 257191Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 257192Species Desulfovibrio africanus [TaxId:873] [54890] (3 PDB entries)
  8. 257193Domain d1keka5: 1kek A:669-785 [68528]
    Other proteins in same PDB: d1keka1, d1keka2, d1keka3, d1keka4, d1kekb1, d1kekb2, d1kekb3, d1kekb4

Details for d1keka5

PDB Entry: 1kek (more details), 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase

SCOP Domain Sequences for d1keka5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keka5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOP Domain Coordinates for d1keka5:

Click to download the PDB-style file with coordinates for d1keka5.
(The format of our PDB-style files is described here.)

Timeline for d1keka5: