Lineage for d1keka2 (1kek A:786-1232)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581036Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 581037Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 581383Family c.36.1.12: PFOR PP module [88771] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. 581384Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species)
  7. 581385Species Desulfovibrio africanus [TaxId:873] [88773] (3 PDB entries)
  8. 581386Domain d1keka2: 1kek A:786-1232 [68525]
    Other proteins in same PDB: d1keka1, d1keka3, d1keka4, d1keka5, d1kekb1, d1kekb3, d1kekb4, d1kekb5

Details for d1keka2

PDB Entry: 1kek (more details), 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase

SCOP Domain Sequences for d1keka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keka2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus}
vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg
asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd
vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw
aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl
armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd
vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda
krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar
pdsgeacdqnragtseqqgdlskrtkk

SCOP Domain Coordinates for d1keka2:

Click to download the PDB-style file with coordinates for d1keka2.
(The format of our PDB-style files is described here.)

Timeline for d1keka2: