Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.8: PFOR Pyr module [88746] (1 protein) domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [88748] (3 PDB entries) |
Domain d1keka1: 1kek A:2-258 [68524] Other proteins in same PDB: d1keka2, d1keka3, d1keka4, d1keka5, d1kekb2, d1kekb3, d1kekb4, d1kekb5 |
PDB Entry: 1kek (more details), 1.9 Å
SCOP Domain Sequences for d1keka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keka1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus} gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg ivaeymqkvasltgrsy
Timeline for d1keka1: