![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
![]() | Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein) domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species) domain I is the Pyr module; domain VI is the PP module |
![]() | Species Desulfovibrio africanus [TaxId:873] [52538] (3 PDB entries) |
![]() | Domain d1keka1: 1kek A:2-258 [68524] Other proteins in same PDB: d1keka3, d1keka4, d1keka5, d1kekb3, d1kekb4, d1kekb5 |
PDB Entry: 1kek (more details), 1.9 Å
SCOP Domain Sequences for d1keka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keka1 c.36.1.4 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus} gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg ivaeymqkvasltgrsy
Timeline for d1keka1: