Lineage for d1keka1 (1kek A:2-258)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242757Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 242758Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
    both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
    conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules
  5. 242896Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. 242897Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species)
    domain I is the Pyr module; domain VI is the PP module
  7. 242898Species Desulfovibrio africanus [TaxId:873] [52538] (3 PDB entries)
  8. 242899Domain d1keka1: 1kek A:2-258 [68524]
    Other proteins in same PDB: d1keka3, d1keka4, d1keka5, d1kekb3, d1kekb4, d1kekb5

Details for d1keka1

PDB Entry: 1kek (more details), 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase

SCOP Domain Sequences for d1keka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keka1 c.36.1.4 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOP Domain Coordinates for d1keka1:

Click to download the PDB-style file with coordinates for d1keka1.
(The format of our PDB-style files is described here.)

Timeline for d1keka1: