SCOP 1.73: Domain d1keeh1: 1kee H:2-152

Lineage for d1keeh1 (1kee H:2-152)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family)

5. Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)

6. Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)

7. Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)

8. Domain d1keeh1: 1kee H:2-152 [68522]
   Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb2, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed2, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef2, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh2
   complexed with 143, adp, cl, k, mn, net, orn, pi

Details for d1keeh1

PDB Entry: 1kee, 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

PDB Compounds: (H:) Carbamoyl-phosphate synthetase small chain

SCOP Domain Sequences for d1keeh1:

Sequence; same for both SEQRES and ATOM records:

>d1keeh1 c.8.3.1 (H:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

Timeline for d1keeh1:

• d1keeh1 first appeared in SCOP 1.59
  
• d1keeh1 appears in SCOP 1.71
  
• d1keeh1 appears in SCOP 1.75
  
• d1keeh1 appears in the current release, SCOPe 2.08