SCOP 1.67: Domain d1keec4: 1kee C:556-676

Lineage for d1keec4 (1kee C:556-676)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (6 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [52451] (9 PDB entries)

8. Domain d1keec4: 1kee C:556-676 [68503]
   Other proteins in same PDB: d1keea1, d1keea2, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec1, d1keec2, d1keec5, d1keec6, d1keed1, d1keed2, d1keee1, d1keee2, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg5, d1keeg6, d1keeh1, d1keeh2

Details for d1keec4

PDB Entry: 1kee, 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keec4:

Sequence; same for both SEQRES and ATOM records:

>d1keec4 c.30.1.1 (C:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

Timeline for d1keec4:

• d1keec4 first appeared in SCOP 1.59
  
• d1keec4 appears in SCOP 1.65
  
• d1keec4 appears in SCOP 1.69
  
• d1keec4 appears in the current release, SCOPe 2.08