Lineage for d1keec3 (1kee C:1-127)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2861873Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2861935Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 2861936Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
    Uniprot P00968
  8. 2861987Domain d1keec3: 1kee C:1-127 [68502]
    Other proteins in same PDB: d1keea1, d1keea2, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec1, d1keec2, d1keec5, d1keec6, d1keed1, d1keed2, d1keee1, d1keee2, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg5, d1keeg6, d1keeh1, d1keeh2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1keec3

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin
PDB Compounds: (C:) Carbamoyl-phosphate synthetase large chain

SCOPe Domain Sequences for d1keec3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keec3 c.30.1.1 (C:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

SCOPe Domain Coordinates for d1keec3:

Click to download the PDB-style file with coordinates for d1keec3.
(The format of our PDB-style files is described here.)

Timeline for d1keec3: