Lineage for d1kcla4 (1kcl A:1-406)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116349Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (13 proteins)
  6. 116407Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 116417Species Bacillus circulans, different strains [TaxId:1397] [51453] (29 PDB entries)
  8. 116418Domain d1kcla4: 1kcl A:1-406 [68448]
    Other proteins in same PDB: d1kcla1, d1kcla2, d1kcla3

Details for d1kcla4

PDB Entry: 1kcl (more details), 1.94 Å

PDB Description: bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l

SCOP Domain Sequences for d1kcla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcla4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhnlg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1kcla4:

Click to download the PDB-style file with coordinates for d1kcla4.
(The format of our PDB-style files is described here.)

Timeline for d1kcla4: