SCOPe 2.06: Domain d1kcla3: 1kcl A:407-495

Lineage for d1kcla3 (1kcl A:407-495)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1kcla3: 1kcl A:407-495 [68447]
   Other proteins in same PDB: d1kcla1, d1kcla2, d1kcla4
   complexed with ca, glc, mal, mpd; mutant

Details for d1kcla3

PDB Entry: 1kcl, 1.94 Å

PDB Description: bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1kcla3:

Sequence; same for both SEQRES and ATOM records:

>d1kcla3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1kcla3:

• d1kcla3 first appeared in SCOP 1.59
  
• d1kcla3 appears in SCOPe 2.05
  
• d1kcla3 appears in SCOPe 2.07
  
• d1kcla3 appears in the current release, SCOPe 2.08