Lineage for d1kcla1 (1kcl A:496-581)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789101Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (5 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 789102Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 789106Domain d1kcla1: 1kcl A:496-581 [68445]
    Other proteins in same PDB: d1kcla2, d1kcla3, d1kcla4
    complexed with ca, glc, mal, mpd; mutant

Details for d1kcla1

PDB Entry: 1kcl (more details), 1.94 Å

PDB Description: bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1kcla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcla1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1kcla1:

Click to download the PDB-style file with coordinates for d1kcla1.
(The format of our PDB-style files is described here.)

Timeline for d1kcla1: