Lineage for d1kcla1 (1kcl A:496-581)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105015Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 105016Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 105017Domain d1kcla1: 1kcl A:496-581 [68445]
    Other proteins in same PDB: d1kcla2, d1kcla3, d1kcla4

Details for d1kcla1

PDB Entry: 1kcl (more details), 1.94 Å

PDB Description: bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l

SCOP Domain Sequences for d1kcla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcla1 b.1.1.5 (A:496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1kcla1:

Click to download the PDB-style file with coordinates for d1kcla1.
(The format of our PDB-style files is described here.)

Timeline for d1kcla1: