Lineage for d1kcka2 (1kck A:582-686)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526162Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 1526163Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 1526196Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 1526197Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 1526217Domain d1kcka2: 1kck A:582-686 [68442]
    Other proteins in same PDB: d1kcka1, d1kcka3, d1kcka4
    complexed with adh, ca, glc; mutant

Details for d1kcka2

PDB Entry: 1kck (more details), 2.43 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant n193g
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1kcka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcka2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOPe Domain Coordinates for d1kcka2:

Click to download the PDB-style file with coordinates for d1kcka2.
(The format of our PDB-style files is described here.)

Timeline for d1kcka2: